PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG003607t1
Common NameTCM_003607
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family bZIP
Protein Properties Length: 299aa    MW: 33493.4 Da    PI: 6.8855
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG003607t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.49.6e-11168211548
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                       kr +r   NR +A+rsR RK+++i eLe+ v +L+ae + L  +
  Thecc1EG003607t1 168 KRVKRILANRQSAQRSRVRKLQYISELERSVTSLQAEVSVLSPR 211
                       8999********************************98877655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.6E-13164228IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.622166218IPR004827Basic-leucine zipper domain
PfamPF001708.7E-9168212IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.2E-11168219No hitNo description
SuperFamilySSF579593.7E-11168222No hitNo description
CDDcd147032.21E-21169219No hitNo description
PROSITE patternPS000360171186IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MAQLPPKIPN WPDMVHQRMP ASATTSSTQQ QNNPCWVDEF LDFSSVRRGT HRRSVSDSIA  60
FLEAPMLEEC RGSNSNAPPG TGGSSNQDFD KFDDEQFMSM FTDDVPNAVA PTVSSSNPSS  120
PSDHNSINDD QKQQMEMIRK ESEEVQSQCK MESQANTNAS TDRIIDPKRV KRILANRQSA  180
QRSRVRKLQY ISELERSVTS LQAEVSVLSP RVAFLDHQRL LLNVDNSALK QRIAALAQDK  240
IFKDAHQEAL KREIERLRQV YHQQNLKKME NAAHSPTPTP PPAADVQASA EKEKLVNV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007050026.10.0Basic-leucine zipper (bZIP) transcription factor family protein, putative
SwissprotQ9M2K41e-125BZP61_ARATH; Basic leucine zipper 61
TrEMBLA0A061DW360.0A0A061DW36_THECC; Basic-leucine zipper (BZIP) transcription factor family protein, putative
STRINGVIT_12s0028g02590.t011e-134(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17532777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.11e-114bZIP family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]